Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A179YEG8
dbSWEET id: dbswt_1591
Accession: A0A179YEG8
Uniprot status: Unreviewed
Organism: Lactobacillus rhamnosus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 101
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A179YEG8|A0A179YEG8_LACRH|Unreviewed|Lactobacillus rhamnosus| 101
MRVDTGKYPDGVDPARIKRLKLLSKLATFTCILMYVSYIPEIIANFSGNPVNPIQPLVAM
INATLWTCYGWLKTYKDWPIIIANMPGILFGLVTFITVFVH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 24 Model end: 100 Inward Open: Template: 4X5M.pdb Model structure: A0A179YEG8_inward.pdb Alignment file: A0A179YEG8_inw.pir Procheck score ⇒ Ramachandran plot: 91.4% favored 7.8% allowed .0% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A179YEG8_outward.pdb Alignment file: A0A179YEG8_out.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 7.0% allowed 2.3% week .0% disallowed Occluded: Model structure: A0A179YEG8_occluded.pdb Alignment file: A0A179YEG8_occ.pir Procheck score ⇒ Ramachandran plot: 91.4% favored 8.6% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA