Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A179EV65

dbSWEET id: dbswt_1590

Accession:   A0A179EV65

Uniprot status:   Unreviewed

Organism:   Enterococcus thailandicus

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Enterococcaceae ⇒ Enterococcus.

Sequence Information back to top


Sequence length:   90

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A179EV65|A0A179EV65_9ENTE|Unreviewed|Enterococcus thailandicus|90
MENEEKREKIIGHIGRVASVLSVMMYVSYIPQIMDNLAGSKGNPIQPLVAMVNCIIWTIY
GTFKKEKDWPIIVANVPGIFLGAITFFTSL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   15     Model end:   91

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A179EV65_inward.pdb    Alignment file: A0A179EV65_inw.pir

Procheck score ⇒ Ramachandran plot: 95.3% favored    3.1% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A179EV65_outward.pdb    Alignment file: A0A179EV65_out.pir

Procheck score ⇒ Ramachandran plot: 89.1% favored    7.0% allowed    2.3% week    1.6% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A179EV65_occluded.pdb    Alignment file: A0A179EV65_occ.pir

Procheck score ⇒ Ramachandran plot: 91.4% favored    6.2% allowed    2.3% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur