Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A176ZE97

dbSWEET id: dbswt_1587

Accession:   A0A176ZE97

Uniprot status:   Unreviewed

Organism:   Bradyrhizobium neotropicale

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rhizobiales ⇒ Bradyrhizobiaceae ⇒ Bradyrhizobium.

Sequence Information back to top


Sequence length:   90

Substrate Binding Site:   QNQN           CVV:   420       CHI:   -14

Selectivity Filter:   AFAF           CVV:   404       CHI:   9.2

Fasta sequence:

>tr|A0A176ZE97|A0A176ZE97_9BRAD|Unreviewed|Bradyrhizobium neotropicale|90
MDLTQIIGFAAGLGTTFAALPDLIAMLKQRSSVGMNPRMAAITGTFQILWVIYGMLIGSS
NIIMWNVIAVVINYLTVGAYVHFRRQEARS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A176ZE97_inward.pdb    Alignment file: A0A176ZE97_inw.pir

Procheck score ⇒ Ramachandran plot: 96.9% favored    3.1% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A176ZE97_outward.pdb    Alignment file: A0A176ZE97_out.pir

Procheck score ⇒ Ramachandran plot: 96.2% favored    3.8% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A176ZE97_occluded.pdb    Alignment file: A0A176ZE97_occ.pir

Procheck score ⇒ Ramachandran plot: 95.4% favored    3.8% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur