Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A175CY90

dbSWEET id: dbswt_1586

Accession:   A0A175CY90

Uniprot status:   Unreviewed

Organism:   Leuconostoc gelidum

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Leuconostoc.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|A0A175CY90|A0A175CY90_LEUGE|Unreviewed|Leuconostoc gelidum|86
MRNRIHDFVGSIGATIGLLVFLAYIPQIISNLNGEKGQPWPPLVAAISCLLWVIYGFTAE
PKKDYILIVPNVAGVIFGLITFFTSF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A175CY90_inward.pdb    Alignment file: A0A175CY90_inw.pir

Procheck score ⇒ Ramachandran plot: 92.7% favored    5.6% allowed    .8% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A175CY90_outward.pdb    Alignment file: A0A175CY90_out.pir

Procheck score ⇒ Ramachandran plot: 92.7% favored    5.6% allowed    .0% week    1.6% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A175CY90_occluded.pdb    Alignment file: A0A175CY90_occ.pir

Procheck score ⇒ Ramachandran plot: 87.9% favored    11.3% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur