Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A175CY90
dbSWEET id: dbswt_1586
Accession: A0A175CY90
Uniprot status: Unreviewed
Organism: Leuconostoc gelidum
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Leuconostoc.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|A0A175CY90|A0A175CY90_LEUGE|Unreviewed|Leuconostoc gelidum|86
MRNRIHDFVGSIGATIGLLVFLAYIPQIISNLNGEKGQPWPPLVAAISCLLWVIYGFTAE
PKKDYILIVPNVAGVIFGLITFFTSF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 10 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: A0A175CY90_inward.pdb Alignment file: A0A175CY90_inw.pir Procheck score ⇒ Ramachandran plot: 92.7% favored 5.6% allowed .8% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A175CY90_outward.pdb Alignment file: A0A175CY90_out.pir Procheck score ⇒ Ramachandran plot: 92.7% favored 5.6% allowed .0% week 1.6% disallowed Occluded: Model structure: A0A175CY90_occluded.pdb Alignment file: A0A175CY90_occ.pir Procheck score ⇒ Ramachandran plot: 87.9% favored 11.3% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA