Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A163X3S6

dbSWEET id: dbswt_1582

Accession:   A0A163X3S6

Uniprot status:   Unreviewed

Organism:   Tardiphaga

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rhizobiales ⇒ Bradyrhizobiaceae ⇒ Tardiphaga.

Sequence Information back to top


Sequence length:   91

Substrate Binding Site:   LNLN           CVV:   440       CHI:   0.6

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|A0A163X3S6|A0A163X3S6_9BRAD|Unreviewed|Tardiphaga|91
MSSILPWVGGFAAVLTSLSYIPQVRKALPRSSTKDLSLKMLVVLTSGLGLWIGYGLLKGD
WIIVLANSIGCALTATVLGCKIRDIRGEDSA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   6     Model end:   83

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A163X3S6_inward.pdb    Alignment file: A0A163X3S6_inw.pir

Procheck score ⇒ Ramachandran plot: 93.8% favored    4.7% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A163X3S6_outward.pdb    Alignment file: A0A163X3S6_out.pir

Procheck score ⇒ Ramachandran plot: 94.5% favored    3.9% allowed    1.6% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A163X3S6_occluded.pdb    Alignment file: A0A163X3S6_occ.pir

Procheck score ⇒ Ramachandran plot: 96.1% favored    3.9% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur