Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A163X3S6
dbSWEET id: dbswt_1582
Accession: A0A163X3S6
Uniprot status: Unreviewed
Organism: Tardiphaga
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rhizobiales ⇒ Bradyrhizobiaceae ⇒ Tardiphaga.
Sequence Information back to top
Sequence length: 91
Substrate Binding Site: LNLN CVV: 440 CHI: 0.6
Selectivity Filter: SGSG CVV: 242 CHI: -2.4
Fasta sequence:
>tr|A0A163X3S6|A0A163X3S6_9BRAD|Unreviewed|Tardiphaga|91
MSSILPWVGGFAAVLTSLSYIPQVRKALPRSSTKDLSLKMLVVLTSGLGLWIGYGLLKGD
WIIVLANSIGCALTATVLGCKIRDIRGEDSA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 6 Model end: 83 Inward Open: Template: 4X5M.pdb Model structure: A0A163X3S6_inward.pdb Alignment file: A0A163X3S6_inw.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 4.7% allowed 1.6% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A163X3S6_outward.pdb Alignment file: A0A163X3S6_out.pir Procheck score ⇒ Ramachandran plot: 94.5% favored 3.9% allowed 1.6% week .0% disallowed Occluded: Model structure: A0A163X3S6_occluded.pdb Alignment file: A0A163X3S6_occ.pir Procheck score ⇒ Ramachandran plot: 96.1% favored 3.9% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA