| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A162AGN3
dbSWEET id: dbswt_1580
Accession: A0A162AGN3
Uniprot status: Unreviewed
Organism: Pseudoalteromonas luteoviolacea
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Alteromonadales ⇒ Pseudoalteromonadaceae ⇒ Pseudoalteromonas.
Sequence Information back to top
Sequence length: 95
Substrate Binding Site: FNFN CVV: 462 CHI: -1.4
Selectivity Filter: AVAV CVV: 344 CHI: 12
Fasta sequence:
>tr|A0A162AGN3|A0A162AGN3_9GAMM|Unreviewed|Pseudoalteromonas luteoviolacea|95
MLKVTWAHFLMSSERHWDMAGVLFGGIGAFALLGQLLNELNRQGDSTLSMSFLLGYVVVF
MFWLLYGLRFKRPAIICTNAVCLVLQSMISMVVLS
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 18 Model end: 95 Inward Open: Template: 4X5M.pdb Model structure: A0A162AGN3_inward.pdb Alignment file: A0A162AGN3_inw.pir Procheck score ⇒ Ramachandran plot: 93.2% favored 4.5% allowed .8% week 1.5% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A162AGN3_outward.pdb Alignment file: A0A162AGN3_out.pir Procheck score ⇒ Ramachandran plot: 93.2% favored 6.1% allowed .8% week .0% disallowed Occluded: Model structure: A0A162AGN3_occluded.pdb Alignment file: A0A162AGN3_occ.pir Procheck score ⇒ Ramachandran plot: 94.7% favored 5.3% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA