Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A158QZ98

dbSWEET id: dbswt_1109

Accession:   A0A158QZ98

Uniprot status:   Unreviewed

Organism:   Nippostrongylus brasiliensis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Strongylida ⇒ Trichostrongyloidea ⇒ Heligmonellidae ⇒ Nippostrongylinae ⇒ Nippostrongylus.

Sequence Information back to top


Sequence length:   220

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LSSV           CVV:   375       CHI:   6.4

Fasta sequence:

>tr|A0A158QZ98|A0A158QZ98_NIPBR|Unreviewed|Nippostrongylus_brasiliensis|220
MSISDEVLPYLSFSAICSTVGLFLCGIQICQRIRQRGTSEGTGSAPFLIAFISCAFWLQY
GFLKNDQVVILVNVIGLVLQGCYLAYYYSMTRNPRLLRKVIAAEFVAISLMLYAVHYAEL
KDKGREPLGIICVVLNIASIGAPLFQVGEVIRTKNSESLPLPLCLACFAVSLQWLLYGIL
VNDYVIQVPNYIATILSIVQLSLFVIYPRRPTFVLLKDSI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   209

Alignment file: A0A158QZ98.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A158QZ98_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.7% favored    8.1% allowed    2.2% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A158QZ98_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.6% favored    4.9% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A158QZ98_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.4% favored    5.9% allowed    1.1% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur