| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A158QZ98
dbSWEET id: dbswt_1109
Accession: A0A158QZ98
Uniprot status: Unreviewed
Organism: Nippostrongylus brasiliensis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Strongylida ⇒ Trichostrongyloidea ⇒ Heligmonellidae ⇒ Nippostrongylinae ⇒ Nippostrongylus.
Sequence Information back to top
Sequence length: 220
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LSSV CVV: 375 CHI: 6.4
Fasta sequence:
>tr|A0A158QZ98|A0A158QZ98_NIPBR|Unreviewed|Nippostrongylus_brasiliensis|220
MSISDEVLPYLSFSAICSTVGLFLCGIQICQRIRQRGTSEGTGSAPFLIAFISCAFWLQY
GFLKNDQVVILVNVIGLVLQGCYLAYYYSMTRNPRLLRKVIAAEFVAISLMLYAVHYAEL
KDKGREPLGIICVVLNIASIGAPLFQVGEVIRTKNSESLPLPLCLACFAVSLQWLLYGIL
VNDYVIQVPNYIATILSIVQLSLFVIYPRRPTFVLLKDSI
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 209
Alignment file: A0A158QZ98.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A158QZ98_inward.pdb
Procheck score ⇒ Ramachandran plot: 89.7% favored 8.1% allowed 2.2% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A158QZ98_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 4.9% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A158QZ98_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.4% favored 5.9% allowed 1.1% week .5% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA