| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A158PD21
dbSWEET id: dbswt_1106
Accession: A0A158PD21
Uniprot status: Unreviewed
Organism: Angiostrongylus costaricensis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Strongylida ⇒ Metastrongyloidea ⇒ Angiostrongylidae ⇒ Angiostrongylus.
Sequence Information back to top
Sequence length: 292
Substrate Binding Site: GTWN CVV: 400 CHI: -5.5
Selectivity Filter: LGDV CVV: 368 CHI: 4.1
Fasta sequence:
>tr|A0A158PD21|A0A158PD21_ANGCS|Unreviewed|Angiostrongylus_costaricensis|292
MFEVFTDGFSFLNLLSLAAFFTTVGLFFCGIPICRQIWKRKDTTEISGAPFLMGVLGGCC
WMTYGYLKKDHTVLVVTGCQVILYSSYSIFYWLMSKEKLFITIKVSVVLAMCAALIGSVK
LFGMKVFHPLGIVCMTLNIGDFAAPLAGLRVVIRRGATSTLPLPLCIANFMVSSEWFLYG
LLVRDIYLITPNGIGSALAVGQLFLFIILPRKPGQRSLIARICGCCGPSEKEIDLEAPIK
EIMPEMDGSEQKSEEHFTRALRWSKKMIANVNTVAEELEHVIGMASIHHQDQ
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 211
Alignment file: A0A158PD21.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A158PD21_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 5.6% allowed 2.8% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A158PD21_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.8% favored 5.6% allowed .6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A158PD21_occluded.pdb
Procheck score ⇒ Ramachandran plot: 88.8% favored 8.4% allowed 1.1% week 1.7% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA