Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A158P642

dbSWEET id: dbswt_1105

Accession:   A0A158P642

Uniprot status:   Unreviewed

Organism:   Angiostrongylus cantonensis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Strongylida ⇒ Metastrongyloidea ⇒ Angiostrongylidae ⇒ Angiostrongylus.

Sequence Information back to top


Sequence length:   222

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   FMSL           CVV:   456       CHI:   7.7

Fasta sequence:

>tr|A0A158P642|A0A158P642_ANGCA|Unreviewed|Angiostrongylus_cantonensis|222
MEITAFTIFTVWLGIFSIFFTLMPFTMVLEWRRRGTADGFSSVNFVLPMLMTSCWLKHGY
MTNDNTNITINTINIVFFILYIALFAYYQPKRKYLYGQLLICGLMLKLIFMYVEIEVASD
VMGSIASATQIASLAGGVYEIKRAISFGHTEYLPAVFQYAMFLLIVQWLAFGLLTGNPYI
AIANVAALIVNVATISLYFVYPPLTWRVPIIGTGPQRGKKEE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   203

Alignment file: A0A158P642.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A158P642_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.3% favored    6.6% allowed    .5% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A158P642_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.9% favored    6.6% allowed    .0% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A158P642_occluded.pdb

Procheck score ⇒ Ramachandran plot: 88.0% favored    11.5% allowed    .5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur