| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A158P642
dbSWEET id: dbswt_1105
Accession: A0A158P642
Uniprot status: Unreviewed
Organism: Angiostrongylus cantonensis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Strongylida ⇒ Metastrongyloidea ⇒ Angiostrongylidae ⇒ Angiostrongylus.
Sequence Information back to top
Sequence length: 222
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: FMSL CVV: 456 CHI: 7.7
Fasta sequence:
>tr|A0A158P642|A0A158P642_ANGCA|Unreviewed|Angiostrongylus_cantonensis|222
MEITAFTIFTVWLGIFSIFFTLMPFTMVLEWRRRGTADGFSSVNFVLPMLMTSCWLKHGY
MTNDNTNITINTINIVFFILYIALFAYYQPKRKYLYGQLLICGLMLKLIFMYVEIEVASD
VMGSIASATQIASLAGGVYEIKRAISFGHTEYLPAVFQYAMFLLIVQWLAFGLLTGNPYI
AIANVAALIVNVATISLYFVYPPLTWRVPIIGTGPQRGKKEE
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 203
Alignment file: A0A158P642.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A158P642_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.3% favored 6.6% allowed .5% week 1.6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A158P642_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.9% favored 6.6% allowed .0% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A158P642_occluded.pdb
Procheck score ⇒ Ramachandran plot: 88.0% favored 11.5% allowed .5% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA