| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A158NJD6
dbSWEET id: dbswt_1104
Accession: A0A158NJD6
Uniprot status: Unreviewed
Organism: Atta cephalotes
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Hymenoptera ⇒ Apocrita ⇒ Aculeata ⇒ Vespoidea ⇒ Formicidae ⇒ Myrmicinae ⇒ Atta.
Sequence Information back to top
Sequence length: 222
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: QLLV CVV: 467 CHI: 8.3
Fasta sequence:
>tr|A0A158NJD6|A0A158NJD6_ATTCE|Unreviewed|Atta_cephalotes|222
MALEDYKEVVGFCAMYTTMAQMLSGTFICRNIHKKGSARGVDPMPFLGTIGLCILMLRYA
WMLGDSNMININIFGLLTNMIYMIIYYYYAPNTKEVLKLIYKVTIFIAIFLVYAQMEHPA
NVEFRFGIVVTVLLLLLIAAPLAHLKNVIKTKNTEILPFPLIFMGTLVSFQWLLYGFIID
NVFIIFQNAIGFILNIAQLSLFVIFPSKKSQVELLNDHRKEN
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 207
Alignment file: A0A158NJD6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A158NJD6_inward.pdb
Procheck score ⇒ Ramachandran plot: 87.6% favored 9.7% allowed .5% week 2.2% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A158NJD6_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 6.5% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A158NJD6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.3% favored 9.2% allowed .0% week .5% disallowed
Gene Informationback to top
Gene ID: 105620766 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5