Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A158NJD6

dbSWEET id: dbswt_1104

Accession:   A0A158NJD6

Uniprot status:   Unreviewed

Organism:   Atta cephalotes

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Hymenoptera ⇒ Apocrita ⇒ Aculeata ⇒ Vespoidea ⇒ Formicidae ⇒ Myrmicinae ⇒ Atta.

Sequence Information back to top


Sequence length:   222

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   QLLV           CVV:   467       CHI:   8.3

Fasta sequence:

>tr|A0A158NJD6|A0A158NJD6_ATTCE|Unreviewed|Atta_cephalotes|222
MALEDYKEVVGFCAMYTTMAQMLSGTFICRNIHKKGSARGVDPMPFLGTIGLCILMLRYA
WMLGDSNMININIFGLLTNMIYMIIYYYYAPNTKEVLKLIYKVTIFIAIFLVYAQMEHPA
NVEFRFGIVVTVLLLLLIAAPLAHLKNVIKTKNTEILPFPLIFMGTLVSFQWLLYGFIID
NVFIIFQNAIGFILNIAQLSLFVIFPSKKSQVELLNDHRKEN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   207

Alignment file: A0A158NJD6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A158NJD6_inward.pdb

Procheck score ⇒ Ramachandran plot: 87.6% favored    9.7% allowed    .5% week    2.2% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A158NJD6_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    6.5% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A158NJD6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.3% favored    9.2% allowed    .0% week    .5% disallowed

Gene Informationback to top


Gene ID:   105620766     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur