Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A158NHL9

dbSWEET id: dbswt_1103

Accession:   A0A158NHL9

Uniprot status:   Unreviewed

Organism:   Atta cephalotes

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Hymenoptera ⇒ Apocrita ⇒ Aculeata ⇒ Vespoidea ⇒ Formicidae ⇒ Myrmicinae ⇒ Atta.

Sequence Information back to top


Sequence length:   217

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   QSFV           CVV:   427       CHI:   2.7

Fasta sequence:

>tr|A0A158NHL9|A0A158NHL9_ATTCE|Unreviewed|Atta_cephalotes|217
MISMEIRNTLALSASICTILQFLAGVLVCKKYIRNGSTGDSSGLAFVTCFMSCSLWLRYG
ILTGDLFIIFVNVFGTILQICYILIYILYNVKRSTTIKQFTIAICLISLVYLYSIFQKNR
VLAEKHIGFLSCSLTILFFASPLISLAHVIRMKSTDSLPFPVIMSSMIVSCQWFVYGCLL
SDQFIQIPNFMGCILSAFQLSLFLIYPSKRTDQAYFI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   208

Alignment file: A0A158NHL9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A158NHL9_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.8% favored    4.7% allowed    .0% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A158NHL9_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.2% favored    5.8% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A158NHL9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.5% favored    8.9% allowed    1.0% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur