| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A151TS79
dbSWEET id: dbswt_719
Accession: A0A151TS79
Uniprot status: Unreviewed
Organism: Cajanus cajan
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Cajanus.
Sequence Information back to top
Sequence length: 247
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMC CVV: 430 CHI: 4.7
Fasta sequence:
>tr|A0A151TS79|A0A151TS79_CAJCA|Unreviewed|Cajanus_cajan|247
MEVAHFLFGIFGNASALFLFLAPVITFKRIIKNRSTEKFSGIPYVMTLLNCLLSAWYGLP
FVSPHNILVSTVNGTGALIEIIYVLIFITLAPRKEKAKILGLFTFVLSVFSAVVFVSLFA
LHANARKLFCGFAPAIFSIIMYGSPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFIFG
LLGRDPFVAVPNGVGSALGTMQLILYFIYREKKGVAKRQAQTEEESMEMGDTKPQQEKQS
NANGTQT
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 211
Alignment file: A0A151TS79.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A151TS79_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.0% favored 4.9% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A151TS79_outward.pdb
Procheck score ⇒ Ramachandran plot: 96.7% favored 2.2% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A151TS79_occluded.pdb
Procheck score ⇒ Ramachandran plot: 95.1% favored 4.4% allowed .5% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA