Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A151TDB3

dbSWEET id: dbswt_116

Accession:   A0A151TDB3

Uniprot status:   Unreviewed

Organism:   Cajanus cajan

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Cajanus.

Sequence Information back to top


Sequence length:   261

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|A0A151TDB3|A0A151TDB3_CAJCA|Unreviewed|Cajanus_cajan|261
MAISHSTLAFAFGMLGNVISFLVFLAPIPTFYRIYKKKSTQEFQSLPYLVALFSSMLWLY
YALLKKDAFLLLTINSFGCVIETIYIILYIIYASRDARNLTSKLFFAMNVGSFALILLVT
HFAVHGALRVQVLGWICVSLSISVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAVMWF
GYGLFLKDICIALPNVLGFALGLIQMLLYGIYRNGDKKVDKMEKKVPLEPLKSVVIAVEE
KQGKENSEEKEKSNEANDCPV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   214

Alignment file: A0A151TDB3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A151TDB3_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.8% favored    4.1% allowed    .0% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A151TDB3_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.3% favored    4.7% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A151TDB3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.3% favored    4.1% allowed    1.0% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur