| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A151SXI3
dbSWEET id: dbswt_253
Accession: A0A151SXI3
Uniprot status: Unreviewed
Organism: Cajanus cajan
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Cajanus.
Sequence Information back to top
Sequence length: 245
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVC CVV: 369 CHI: 10.1
Fasta sequence:
>tr|A0A151SXI3|A0A151SXI3_CAJCA|Unreviewed|Cajanus_cajan|245
IGNIVSFLVFLAPLPTFYTIYKNKSSEGFQSIPYVVALLSALLLLYYGFIKTNATLIITI
NCIGCAIEVSYLTMYIIYAPKKQKISTMVLILICDVGGFGLTMLISTFAVKGINRVHAVG
WICAIFNIAVFAAPLSIMRRVIKTKSVEYMPFSLSLFLTLCATMWFFYGFFDKDYFIMLP
NVLGFLFGISQMILYMIYKKAGKNIKTNCTQQQEREGTENSKQHSCDGYKIDIPSLVEMK
ENQLN
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 200
Alignment file: A0A151SXI3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A151SXI3_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.7% favored 4.5% allowed 1.1% week 1.7% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A151SXI3_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.7% favored 5.1% allowed 1.7% week .6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A151SXI3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.8% favored 6.2% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA