Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A151SV32

dbSWEET id: dbswt_561

Accession:   A0A151SV32

Uniprot status:   Unreviewed

Organism:   Cajanus cajan

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Cajanus.

Sequence Information back to top


Sequence length:   259

Substrate Binding Site:   CNWS           CVV:   418       CHI:   -2.7

Selectivity Filter:   LNMA           CVV:   411       CHI:   4

Fasta sequence:

>tr|A0A151SV32|A0A151SV32_CAJCA|Unreviewed|Cajanus_cajan|259
MSESLRLAVAVLGNAASVSLYAAPMVTFKRVIRKKSTEEFSCIPYIIGLLNCLLYTWYGL
PVVSYKWENFPLVTVNGVGIALELSYVLIYFWYASAKGKRKVAMTAIPVLLLFSIIAAVS
AFAFHDNRHRKLLVGSIGLGVSVAMYASPLVVMKKVIQTKSVEFMPLPLSVCSFLATLLW
LTYGLLIRDIFVAGPSVIGTPLGILQLVIYFKYRKGSAVEEPNKGDTEKGNLEKVDIEIG
KLEMNVTNHMNGITREQCV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   215

Alignment file: A0A151SV32.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A151SV32_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.5% favored    5.3% allowed    3.2% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A151SV32_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.1% favored    5.8% allowed    2.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A151SV32_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    4.8% allowed    2.1% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur