Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A151RRE3

dbSWEET id: dbswt_167

Accession:   A0A151RRE3

Uniprot status:   Unreviewed

Organism:   Cajanus cajan

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Cajanus.

Sequence Information back to top


Sequence length:   256

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVN           CVV:   379       CHI:   4.1

Fasta sequence:

>tr|A0A151RRE3|A0A151RRE3_CAJCA|Unreviewed|Cajanus_cajan|256
MAMHRESWAFVFGLLGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIY
YAFVKKEAALLLITINTFGIVVESIYLAIFLFYAPRKPRLSTIKLLLLLNVFGFGAMLLS
TLYLSKGAKRLAIIGWICLVFNISVFAAPLFIIRRVIKTRSVEYMPFTLSMFLTINAVMW
FFYGLLLKDYYVALPNTLGFLFGIIQMVMYLIYRNATPVALEPVKAQELNGHIIDVVKSG
AMGPNHATTGGGVGKV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   215

Alignment file: A0A151RRE3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A151RRE3_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    5.2% allowed    1.0% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A151RRE3_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    5.2% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A151RRE3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.2% favored    4.7% allowed    2.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur