Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A151MST2

dbSWEET id: dbswt_1101

Accession:   A0A151MST2

Uniprot status:   Unreviewed

Organism:   Alligator mississippiensis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Archelosauria ⇒ Archosauria ⇒ Crocodylia ⇒ Alligatoridae ⇒ Alligatorinae ⇒ Alligator.

Sequence Information back to top


Sequence length:   217

Substrate Binding Site:   NNWN           CVV:   451       CHI:   -11.4

Selectivity Filter:   MNMA           CVV:   411       CHI:   2.1

Fasta sequence:

>tr|A0A151MST2|A0A151MST2_ALLMI|Unreviewed|Alligator_mississippiensis|217
MEPWALLPVACTACSLAMFATGLSDLRQMVMTRSVEHIQFLPFLTTDVNNLSWLSYGCLK
QDWTLIAVNTVGATLQTLYILVYFYFSPEKRRVLLWSLALLGLLVLGYCYFSLLVLDLDT
RLTRLGLFCSTFTISMYLSPLADLAKIIRTRSTRCLSFPLTVATFLASTSWTLYGLQLHD
LYIMVPNVPGIVTSLLRFWLFWQYPPSLDKPYKSLQA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   206

Alignment file: A0A151MST2.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A151MST2_inward.pdb

Procheck score ⇒ Ramachandran plot: 87.7% favored    10.2% allowed    .5% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A151MST2_outward.pdb

Procheck score ⇒ Ramachandran plot: 90.9% favored    7.0% allowed    1.1% week    1.1% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A151MST2_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.4% favored    7.5% allowed    1.1% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur