| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A151DY78
dbSWEET id: dbswt_2057
Accession: A0A151DY78
Uniprot status: Unreviewed
Organism: Thermoplasmatales archaeon
Kingdom: Archaea
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: MNMN CVV: 440 CHI: -3.2
Selectivity Filter: GGGG CVV: 192 CHI: -1.6
Fasta sequence:
>tr|A0A151DY78|A0A151DY78_9EURY|Unreviewed|Thermoplasmatales archaeon|86
MNFDLFTLLGFSAGAVTSVGFIPQLIRGYRTKKLHDISYWMPMVLMSGMALWLIYGVLRN
DIAIIAANSFGVLCNILLLLMKKRYS
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 7 Model end: 84 Inward Open: Template: 4X5M.pdb Model structure: A0A151DY78_inward.pdb Alignment file: A0A151DY78_inw.pir Procheck score ⇒ Ramachandran plot: 94.7% favored 3.8% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A151DY78_outward.pdb Alignment file: A0A151DY78_out.pir Procheck score ⇒ Ramachandran plot: 95.5% favored 4.5% allowed .0% week .0% disallowed Occluded: Model structure: A0A151DY78_occluded.pdb Alignment file: A0A151DY78_occ.pir Procheck score ⇒ Ramachandran plot: 97.7% favored 2.3% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA