Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A150FD47

dbSWEET id: dbswt_1572

Accession:   A0A150FD47

Uniprot status:   Unreviewed

Organism:   Leptospira

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Spirochaetes ⇒ Leptospirales ⇒ Leptospiraceae ⇒ Leptospira.

Sequence Information back to top


Sequence length:   96

Substrate Binding Site:   VNVN           CVV:   402       CHI:   1.4

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|A0A150FD47|A0A150FD47_9LEPT|Unreviewed|Leptospira|96
MDSITFLGYIASLLTTISFLPQLIRILMGGSTKDISRNMYIVLVTGVLLWFIYGCLKQDF
PIILANAFTFLFAATILYFKLKSDFKVKLKNKSNEK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A150FD47_inward.pdb    Alignment file: A0A150FD47_inw.pir

Procheck score ⇒ Ramachandran plot: 93.4% favored    5.1% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A150FD47_outward.pdb    Alignment file: A0A150FD47_out.pir

Procheck score ⇒ Ramachandran plot: 96.3% favored    3.7% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A150FD47_occluded.pdb    Alignment file: A0A150FD47_occ.pir

Procheck score ⇒ Ramachandran plot: 98.5% favored    1.5% allowed    .0% week    .0% disallowed

Gene Informationback to top


Gene ID:   23004118

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur