Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A146KPY9

dbSWEET id: dbswt_1097

Accession:   A0A146KPY9

Uniprot status:   Unreviewed

Organism:   Lygus hesperus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Paraneoptera ⇒ Hemiptera ⇒ Euhemiptera ⇒ Heteroptera ⇒ Panheteroptera ⇒ Cimicomorpha ⇒ Miridae ⇒ Mirini ⇒ Lygus.

Sequence Information back to top


Sequence length:   215

Substrate Binding Site:   GNWN           CVV:   442       CHI:   -2

Selectivity Filter:   QILV           CVV:   467       CHI:   9

Fasta sequence:

>tr|A0A146KPY9|A0A146KPY9_LYGHE|Unreviewed|Lygus_hesperus|215
MPLKDYQDIVGSTAAVVTIAQFFSPLFICKKIVSQGNTNNVDPTPFVGGIGIGLLFLRHG
YLLNDPAMIPVNLFAIGLNIIYFLIFLAYSDCRGAIFTNLVKSVVGACAIVSYTFIDPNN
ERVLTVYGTMVTGLMFALIAAPLKDLKEIIKNQDTGSLPFPMILSGTVVMSLWFLYGVIL
ENVFIIIQNGVGLLLSAVQLSLFVIYPSKPSKKVD

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   208

Alignment file: A0A146KPY9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A146KPY9_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.4% favored    7.3% allowed    1.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A146KPY9_outward.pdb

Procheck score ⇒ Ramachandran plot: 88.8% favored    10.7% allowed    .6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A146KPY9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.9% favored    9.0% allowed    .6% week    .6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur