Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A146KPY9
dbSWEET id: dbswt_1097
Accession: A0A146KPY9
Uniprot status: Unreviewed
Organism: Lygus hesperus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Paraneoptera ⇒ Hemiptera ⇒ Euhemiptera ⇒ Heteroptera ⇒ Panheteroptera ⇒ Cimicomorpha ⇒ Miridae ⇒ Mirini ⇒ Lygus.
Sequence Information back to top
Sequence length: 215
Substrate Binding Site: GNWN CVV: 442 CHI: -2
Selectivity Filter: QILV CVV: 467 CHI: 9
Fasta sequence:
>tr|A0A146KPY9|A0A146KPY9_LYGHE|Unreviewed|Lygus_hesperus|215
MPLKDYQDIVGSTAAVVTIAQFFSPLFICKKIVSQGNTNNVDPTPFVGGIGIGLLFLRHG
YLLNDPAMIPVNLFAIGLNIIYFLIFLAYSDCRGAIFTNLVKSVVGACAIVSYTFIDPNN
ERVLTVYGTMVTGLMFALIAAPLKDLKEIIKNQDTGSLPFPMILSGTVVMSLWFLYGVIL
ENVFIIIQNGVGLLLSAVQLSLFVIYPSKPSKKVD
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 208
Alignment file: A0A146KPY9.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A146KPY9_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.4% favored 7.3% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A146KPY9_outward.pdb
Procheck score ⇒ Ramachandran plot: 88.8% favored 10.7% allowed .6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A146KPY9_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.9% favored 9.0% allowed .6% week .6% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5