Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A142KQ05
dbSWEET id: dbswt_1570
Accession: A0A142KQ05
Uniprot status: Unreviewed
Organism: Lactobacillus oris
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 95
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A142KQ05|A0A142KQ05_9LACO|Unreviewed|Lactobacillus oris|95
MDNQKLTTKQKVRKFTGNFATIACLVMYFSYIEQIIANFTGQPVSPVQPFFASINALLWV
IYGWVKPDKKDWPVIIANFPGIIFGLVTAITSFVH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 17 Model end: 94 Inward Open: Template: 4X5M.pdb Model structure: A0A142KQ05_inward.pdb Alignment file: A0A142KQ05_inw.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 5.4% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A142KQ05_outward.pdb Alignment file: A0A142KQ05_out.pir Procheck score ⇒ Ramachandran plot: 91.5% favored 6.2% allowed 2.3% week .0% disallowed Occluded: Model structure: A0A142KQ05_occluded.pdb Alignment file: A0A142KQ05_occ.pir Procheck score ⇒ Ramachandran plot: 86.2% favored 10.8% allowed 2.3% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA