Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A142DVI5

dbSWEET id: dbswt_235

Accession:   A0A142DVI5

Uniprot status:   Unreviewed

Organism:   Solanum tuberosum

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum.

Sequence Information back to top


Sequence length:   289

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|A0A142DVI5|A0A142DVI5_SOLTU|Unreviewed|Solanum_tuberosum|289
MADFSVHWVFAFGVLGNIVSFFVFLSPLPTFCKMYKKNSTEGYQSIPYVVALFSAMLWIY
YAFLKTNTTLLITINTFGCFVEIIYVGFYLFYASKEARVQTIKLLLLLVVGGFGAIVLVS
QFLFEGAVRVQVVGWICLVCSLCVFVAPLCIVKQVIKTKSVEYMPFLLSVFLTLSAVMWF
FYGLLLKDFNIAIPNVLGFIFGILQMVLYVMYYNKKEEEFVKEQNLPELKNHVIILHNDK
KFPELSEEQIIEIVKLGSLISCTQKFDLALCLHENIAEDHKRLRKTLEI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   214

Alignment file: A0A142DVI5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A142DVI5_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.6% favored    7.9% allowed    .0% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A142DVI5_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    5.2% allowed    2.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A142DVI5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    4.2% allowed    1.0% week    .5% disallowed

Gene Informationback to top


Gene ID:   102587377     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur