Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A142DVI3

dbSWEET id: dbswt_153

Accession:   A0A142DVI3

Uniprot status:   Unreviewed

Organism:   Solanum tuberosum

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum.

Sequence Information back to top


Sequence length:   276

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|A0A142DVI3|A0A142DVI3_SOLTU|Unreviewed|Solanum_tuberosum|276
MTSVSHTHPLVFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLW
IYYAMVKTNVTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILF
LTQILCQGTKRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVM
WFLYGLLLKDFYVAVPNISGMILGVLQMILYGIYRNSKSNNVATEKELPTVVKVDQELPP
KVNCEVYPVNISSLDSENGEGKDGKNLEDSQINSQV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   216

Alignment file: A0A142DVI3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A142DVI3_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    6.4% allowed    .0% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A142DVI3_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    4.3% allowed    1.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A142DVI3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.7% favored    4.8% allowed    .5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur