Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A142DVH8
dbSWEET id: dbswt_236
Accession: A0A142DVH8
Uniprot status: Unreviewed
Organism: Solanum tuberosum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum.
Sequence Information back to top
Sequence length: 287
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A142DVH8|A0A142DVH8_SOLTU|Unreviewed|Solanum_tuberosum|287
MAGFSDHWTFAFGVLGNIISFFVFLSPLPTFYNIYKKKSTEGYQSIPYVVALFSAMLWIY
YAFLKTNTTLLVTINTFGCFIETLYVGFYLFYAPKKARVQTIKLLLLLVVGGFGAIVLVT
QFLFKGAIRAQIVGWICLVFSLCVFVAPLCIVRQVIKTKSVEYMPFLLSVFLTLSAVMWF
FYGLLLKDFNIAIPNVLGFIFGILQMILYVMYNKKEEVVIKEQNLPELKDHVIILEDDKK
KLPELSEEQIINIMKLGSLVYSEKNYGNLNEVAKNDKVVSKLQTVEA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 214
Alignment file: A0A142DVH8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A142DVH8_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 4.8% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A142DVH8_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 4.2% allowed 2.1% week 1.1% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A142DVH8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 6.3% allowed 1.1% week .5% disallowed
Gene Informationback to top
Gene ID: 102587047 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22