| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A142DVH6
dbSWEET id: dbswt_220
Accession: A0A142DVH6
Uniprot status: Unreviewed
Organism: Solanum tuberosum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum.
Sequence Information back to top
Sequence length: 297
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A142DVH6|A0A142DVH6_SOLTU|Unreviewed|Solanum_tuberosum|297
MSGISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTDGYQSIPYVVALFSSMLWIY
YALLKTNTTLLITINSFGVFIETIYVAFYLFYAPKKSRVQTIKMILLFVVCGFGAIILVT
EFLFKGAVRGQVVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSIFLTLSAVVWF
FYGLLLKDINIAIPNVLGFILGILQMVLYVIYNKKEKAILKEQKLPEKLQNHMIISIDEK
NKNFPELTEEQIIDIVKLGSLISSGKIHIASCLHDAVCASAKIENTPNNLQTVEAKN
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 2 Model end: 214
Alignment file: A0A142DVH6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A142DVH6_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 5.3% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A142DVH6_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 4.3% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A142DVH6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.5% favored 7.4% allowed .5% week .5% disallowed
Gene Informationback to top
Gene ID: 107060684 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA