Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A142DVG8

dbSWEET id: dbswt_788

Accession:   A0A142DVG8

Uniprot status:   Unreviewed

Organism:   Solanum tuberosum

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum.

Sequence Information back to top


Sequence length:   252

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMN           CVV:   440       CHI:   -1.3

Fasta sequence:

>tr|A0A142DVG8|A0A142DVG8_SOLTU|Unreviewed|Solanum_tuberosum|252
MLLNRDNARFAVGVIGNIIALILFLSPLTTFVRIWKSKSVEQFSPIPYLATFINCGLWVM
YGLPWVTPNSLLVITINGTGLGIEIVYLTLFLLYSDRKQRMKVIIIVIVEIIFVVALGFV
VLTFVHEPKKRAAIVGSICMVGNIMMYAAPLSVMKLVIKTKSVEYMPFFLSLFSFLNGVS
WTSYALIRFDAYILAPNSMGTLLGLAQLLIYAAFYKSTKRQMAAREAKGEMVMTEKSVSG
RVAQNPRNDSRV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   216

Alignment file: A0A142DVG8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A142DVG8_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    6.8% allowed    .5% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A142DVG8_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.6% favored    5.8% allowed    1.6% week    1.1% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A142DVG8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    4.2% allowed    1.6% week    .5% disallowed

Gene Informationback to top


Gene ID:   102600110     Total Exons:   5     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur