Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A142DVG7

dbSWEET id: dbswt_791

Accession:   A0A142DVG7

Uniprot status:   Unreviewed

Organism:   Solanum tuberosum

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum.

Sequence Information back to top


Sequence length:   263

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMC           CVV:   430       CHI:   4.7

Fasta sequence:

>tr|A0A142DVG7|A0A142DVG7_SOLTU|Unreviewed|Solanum_tuberosum|263
MVIDREHAHVAFGLFGSINAFILLLSPLPTFIHMWKKKSVEKFSPFPYIVAFLNCGLWLL
YGLPWIQQQGSLLIMTINRIGLAIDMVYLMLFVLYSKKEKRMKIFFIILSEIVFIGSLAI
LVITLVHCHKKRYTIVGTICMVANILMYASPLTIMKLVIKTKSVEYMPFYLSFFSFLCSI
SWTAYAIISVDFYLLTANVMGAMLGLAQLMLYATYYKYTGRQITERQTQGKLDLVEKTVS
GAAQKASNEAALVFNLMFGRPIF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   217

Alignment file: A0A142DVG7.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A142DVG7_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.4% favored    4.1% allowed    1.0% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A142DVG7_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    6.6% allowed    1.0% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A142DVG7_occluded.pdb

Procheck score ⇒ Ramachandran plot: 95.9% favored    4.1% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur