Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A142DVG5
dbSWEET id: dbswt_870
Accession: A0A142DVG5
Uniprot status: Unreviewed
Organism: Solanum tuberosum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum.
Sequence Information back to top
Sequence length: 233
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|A0A142DVG5|A0A142DVG5_SOLTU|Unreviewed|Solanum_tuberosum|233
MVMSADNIRFVVGIIGNVLSFVLFASPVPTFCRIIKNKSVEEFHPYPYLASTMNCMMWIF
YGMPFVHPHSVLVVTINSIGLFMQLCYISIFFFYTGKRYRLQIVSILFGEIVGLAAAVAG
TMLGLHTYASRTTVVGILATAFGICMYGSPLTIMYKVIKTKSAEFLPKTLSIACFLNGIC
WAGYALLKFDPYILTGNGVGALLALVQLALIVIYRNPPPKDEKPSKVELQNVV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 216
Alignment file: A0A142DVG5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A142DVG5_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 3.2% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A142DVG5_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.5% favored 5.9% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A142DVG5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 95.2% favored 3.8% allowed .0% week 1.1% disallowed
Gene Informationback to top
Gene ID: 102587850 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA