Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A142DVG4

dbSWEET id: dbswt_549

Accession:   A0A142DVG4

Uniprot status:   Unreviewed

Organism:   Solanum tuberosum

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum.

Sequence Information back to top


Sequence length:   261

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMA           CVV:   411       CHI:   4

Fasta sequence:

>tr|A0A142DVG4|A0A142DVG4_SOLTU|Unreviewed|Solanum_tuberosum|261
MGERLRLAVGVMGNVASMLLYAAPMLTFSRVMKKKNIEGFSCVPYVLALFNCCLYTWYGL
PIVSYKWEDFPVVTINGIGILLEISFILIYFWFSSTKGKKEVAKMVVPIILICVATGIIS
TFVFHEHRRRKVFVGSIGLVASIAMYASPLVVVRQVIKTKSVEFMPFYLSLFSFLASGLW
MAYGLLSHDLFLASPNMVGTPLCILQLILYFKYRKNPVKELEPQKWPDLEYNDDKLKQEF
KLEEKKDQSMLVVTENLSTKT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   215

Alignment file: A0A142DVG4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A142DVG4_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    3.7% allowed    1.1% week    2.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A142DVG4_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.5% favored    6.3% allowed    1.6% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A142DVG4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.1% favored    5.8% allowed    1.6% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur