| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A142DVG4
dbSWEET id: dbswt_549
Accession: A0A142DVG4
Uniprot status: Unreviewed
Organism: Solanum tuberosum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum.
Sequence Information back to top
Sequence length: 261
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMA CVV: 411 CHI: 4
Fasta sequence:
>tr|A0A142DVG4|A0A142DVG4_SOLTU|Unreviewed|Solanum_tuberosum|261
MGERLRLAVGVMGNVASMLLYAAPMLTFSRVMKKKNIEGFSCVPYVLALFNCCLYTWYGL
PIVSYKWEDFPVVTINGIGILLEISFILIYFWFSSTKGKKEVAKMVVPIILICVATGIIS
TFVFHEHRRRKVFVGSIGLVASIAMYASPLVVVRQVIKTKSVEFMPFYLSLFSFLASGLW
MAYGLLSHDLFLASPNMVGTPLCILQLILYFKYRKNPVKELEPQKWPDLEYNDDKLKQEF
KLEEKKDQSMLVVTENLSTKT
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: A0A142DVG4.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A142DVG4_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 3.7% allowed 1.1% week 2.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A142DVG4_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.5% favored 6.3% allowed 1.6% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A142DVG4_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 5.8% allowed 1.6% week .5% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA