Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A142DVG3
dbSWEET id: dbswt_662
Accession: A0A142DVG3
Uniprot status: Unreviewed
Organism: Solanum tuberosum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum.
Sequence Information back to top
Sequence length: 235
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|A0A142DVG3|A0A142DVG3_SOLTU|Unreviewed|Solanum_tuberosum|235
MVSLASSQVIEICKDAAGMAGNIFAFGLFLSPMPTFMRIMRNQSTEQFSGLPYIYGLLNC
LICAWYGTPLVSPDNLLVTSVNSVGAVFQLAYIVLYVMYTEKEKKFRMFGWILTVFGLFA
IIVIGSLFILDLELRRVIIGTLSCASLISMFASPLLIINLVIRTRSVEFMPFFLSLSSFL
MSASFLLYGIFSFDPFIYVPNGIGTLLGVVQLLLFAHYRNSSREDSAEGLIVSYS
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 7 Model end: 220
Alignment file: A0A142DVG3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A142DVG3_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 3.7% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A142DVG3_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 5.9% allowed .0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A142DVG3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 4.8% allowed 1.1% week .0% disallowed
Gene Informationback to top
Gene ID: 102589550 Total Exons: 7 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA