Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A142DVG2
dbSWEET id: dbswt_677
Accession: A0A142DVG2
Uniprot status: Unreviewed
Organism: Solanum tuberosum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum.
Sequence Information back to top
Sequence length: 237
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|A0A142DVG2|A0A142DVG2_SOLTU|Unreviewed|Solanum_tuberosum|237
MEISGAGGLFSTYSICSNAAGIAGNLFAFVLFVSPIPTFRRIIRNKSTEQFSGLPYIYAL
LNCLICLWYGTPIVSPGIILVFTVNSVGAVFQLAYILIFIVYAERTKKLKMLGLLFGVFT
AFAAVFSISICLFQPPNRQTFVGYLSVISLISMFASPLFIINLVIRTRSVEYMPFYLSLA
TFLMSLSFFAYGMFKKDPFIYVPNGIGGVLGIIQLVLYWRYSRPNEEPTRPLLESNA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 10 Model end: 223
Alignment file: A0A142DVG2.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A142DVG2_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 3.8% allowed 1.6% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A142DVG2_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 4.8% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A142DVG2_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 4.8% allowed 1.1% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA