Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A142DVF8
dbSWEET id: dbswt_694
Accession: A0A142DVF8
Uniprot status: Unreviewed
Organism: Solanum tuberosum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum.
Sequence Information back to top
Sequence length: 228
Substrate Binding Site: CNWT CVV: 438 CHI: -2.6
Selectivity Filter: LNMS CVV: 417 CHI: 1.4
Fasta sequence:
>tr|A0A142DVF8|A0A142DVF8_SOLTU|Unreviewed|Solanum_tuberosum|228
MGDLVHTVQFVFGIFGNVASLFLFLVPMYTFKRIIKNKSTEQFSGIPYVMTLLNCLLTAW
YGLPFITSNNILVATINGVGAAIELTYVFIFLLYGSNKQKRKILVIFVLVLIAFATAAVI
SISFFHGKNRRFFCGMAATIITVVMYASPLSNIRLVIRTKSVEYMPFFLSFAVVVSCTNW
FIYGMLGMDLFIGISTCIGLILGVVQLILYFIYREKKTSTAVDEFQYA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 215
Alignment file: A0A142DVF8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A142DVF8_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.8% favored 3.1% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A142DVF8_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.8% favored 3.6% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A142DVF8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.3% favored 3.6% allowed 1.6% week .5% disallowed
Gene Informationback to top
Gene ID: 102600141 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA