Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A142DVF6

dbSWEET id: dbswt_743

Accession:   A0A142DVF6

Uniprot status:   Unreviewed

Organism:   Solanum tuberosum

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Solanoideae ⇒ Solaneae ⇒ Solanum.

Sequence Information back to top


Sequence length:   250

Substrate Binding Site:   CAWN           CVV:   412       CHI:   -0.1

Selectivity Filter:   LNMS           CVV:   417       CHI:   1.4

Fasta sequence:

>tr|A0A142DVF6|A0A142DVF6_SOLTU|Unreviewed|Solanum_tuberosum|250
MGHVHVIRILHTTFGIFGNVFGILLFLAPMITFKRIIMKRSTEKFSGVPYLMSLFNCLFS
AWYGLPFVSPNNTLLTVLASIGGALEAIYVLIFLIFAPKKEKFKISGILFLVLSIFSIVA
LVSVLKLHGDKRKLLCGLAFAITCIMMFGAPLTVMRQVIKSKSVEYMPFFLSLSIFNSST
SWAIYGLLGKDPFIIVPNSVGSLLACVQLILYAIYRDSKKKLDVETEGSIETGHEKPQIE
IQKNMETYAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   217

Alignment file: A0A142DVF6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A142DVF6_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.7% favored    3.2% allowed    1.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A142DVF6_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.7% favored    2.7% allowed    1.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A142DVF6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    5.3% allowed    .5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur