Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A139ZK65

dbSWEET id: dbswt_1993

Accession:   A0A139ZK65

Uniprot status:   Unreviewed

Organism:   Rickettsia raoultii.OG

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rickettsiales ⇒ Rickettsiaceae ⇒ Rickettsieae ⇒ Rickettsia ⇒ spotted fever group.

Sequence Information back to top


Sequence length:   92

Substrate Binding Site:   LELE           CVV:   466       CHI:   0.6

Selectivity Filter:   MLML           CVV:   496       CHI:   11.4

Fasta sequence:

>tr|A0A139ZK65|A0A139ZK65_9RICK|Unreviewed|Rickettsia raoultii.OG|92
MHNQKSNTSNYYEYYIMIVGILGQSMHYIQAYKIFSTQSAEDISLPAYLICLFLLINWLI
YGVVKKAKALIYAEILGMVGCSAIIIGTYLYN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   13     Model end:   90

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A139ZK65_inward.pdb    Alignment file: A0A139ZK65_inw.pir

Procheck score ⇒ Ramachandran plot: 89.0% favored    10.3% allowed    .0% week    .7% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A139ZK65_outward.pdb    Alignment file: A0A139ZK65_out.pir

Procheck score ⇒ Ramachandran plot: 90.4% favored    7.4% allowed    1.5% week    .7% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A139ZK65_occluded.pdb    Alignment file: A0A139ZK65_occ.pir

Procheck score ⇒ Ramachandran plot: 94.9% favored    5.1% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur