Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A139QGY5

dbSWEET id: dbswt_1564

Accession:   A0A139QGY5

Uniprot status:   Unreviewed

Organism:   Streptococcus constellatus

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus ⇒ Streptococcus anginosus group.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A139QGY5|A0A139QGY5_STRCV|Unreviewed|Streptococcus constellatus|86
MNEKRMKMIGWVATFMSVMMYVSYIPQIMDNLAGHKGNFIQPLVAAINCSLWVYYGLFKK
ERDLPLAAANAPGIVFGLITVLTAMF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A139QGY5_inward.pdb    Alignment file: A0A139QGY5_inw.pir

Procheck score ⇒ Ramachandran plot: 90.8% favored    4.6% allowed    3.8% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A139QGY5_outward.pdb    Alignment file: A0A139QGY5_out.pir

Procheck score ⇒ Ramachandran plot: 93.8% favored    6.2% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A139QGY5_occluded.pdb    Alignment file: A0A139QGY5_occ.pir

Procheck score ⇒ Ramachandran plot: 93.8% favored    3.8% allowed    2.3% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur