Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A139QCR2
dbSWEET id: dbswt_1563
Accession: A0A139QCR2
Uniprot status: Unreviewed
Organism: Streptococcus mitis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 81
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A139QCR2|A0A139QCR2_STRMT|Unreviewed|Streptococcus mitis|81
MKVLGWVATFMSVMMYVSYFPQIMNNLAGQKGNFIQPLVAIINCSLWVYYGLFKKERDIP
FAAANALGIVFGLVTAITALI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 81 Inward Open: Template: 4X5M.pdb Model structure: A0A139QCR2_inward.pdb Alignment file: A0A139QCR2_inw.pir Procheck score ⇒ Ramachandran plot: 90.9% favored 8.3% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A139QCR2_outward.pdb Alignment file: A0A139QCR2_out.pir Procheck score ⇒ Ramachandran plot: 93.9% favored 4.5% allowed 1.5% week .0% disallowed Occluded: Model structure: A0A139QCR2_occluded.pdb Alignment file: A0A139QCR2_occ.pir Procheck score ⇒ Ramachandran plot: 91.7% favored 6.1% allowed 2.3% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA