Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A139P8W5
dbSWEET id: dbswt_1560
Accession: A0A139P8W5
Uniprot status: Unreviewed
Organism: Streptococcus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A139P8W5|A0A139P8W5_9STRE|Unreviewed|Streptococcus|86
MKEKHMLILGWVATFMSVMMYVSYIPQIVNNLAGNKGDFIQPSVAALNCTLWVIYGLFKE
KRDIPLAAANMPGIVFGLITAVTALL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 10 Model end: 86
Inward Open:
Template: 4X5M.pdb
Model structure: A0A139P8W5_inward.pdb Alignment file: A0A139P8W5_inw.pir
Procheck score ⇒ Ramachandran plot: 93.1% favored 6.2% allowed .8% week .0% disallowed
Outward Open:
Template: 4X5N.pdb
Model structure: A0A139P8W5_outward.pdb Alignment file: A0A139P8W5_out.pir
Procheck score ⇒ Ramachandran plot: 93.1% favored 3.8% allowed .8% week 2.3% disallowed
Occluded:
Model structure: A0A139P8W5_occluded.pdb Alignment file: A0A139P8W5_occ.pir
Procheck score ⇒ Ramachandran plot: 88.5% favored 9.2% allowed .0% week 2.3% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA