Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A139NC69

dbSWEET id: dbswt_1557

Accession:   A0A139NC69

Uniprot status:   Unreviewed

Organism:   Streptococcus

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.

Sequence Information back to top


Sequence length:   79

Substrate Binding Site:   ININ           CVV:   440       CHI:   2

Selectivity Filter:   AGAG           CVV:   230       CHI:   2.8

Fasta sequence:

>tr|A0A139NC69|A0A139NC69_9STRE|Unreviewed|Streptococcus|79
MIGSIAAILTTFAFLPQVVRVIKTKDTESIALGMYVMQVIGIALWLAHGLRIGDIPLILA
NSVSFLLSGIILIYKLKYK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   3     Model end:   77

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A139NC69_inward.pdb    Alignment file: A0A139NC69_inw.pir

Procheck score ⇒ Ramachandran plot: 93.8% favored    5.4% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A139NC69_outward.pdb    Alignment file: A0A139NC69_out.pir

Procheck score ⇒ Ramachandran plot: 93.1% favored    6.9% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A139NC69_occluded.pdb    Alignment file: A0A139NC69_occ.pir

Procheck score ⇒ Ramachandran plot: 95.4% favored    4.6% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur