Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A137RM18

dbSWEET id: dbswt_1554

Accession:   A0A137RM18

Uniprot status:   Unreviewed

Organism:   Vitellibacter

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Vitellibacter.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   VNVN           CVV:   402       CHI:   1.4

Selectivity Filter:   AGAG           CVV:   230       CHI:   2.8

Fasta sequence:

>tr|A0A137RM18|A0A137RM18_9FLAO|Unreviewed|Vitellibacter|86
MEVQIIGFIAGLLTTIAVLPQLLKSWKTKKVLDISPAMFMLLLGGVGLWVIYGIIKMDYP
IIITNGISFLLNASMLFIMMRYKTED

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   81

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A137RM18_inward.pdb    Alignment file: A0A137RM18_inw.pir

Procheck score ⇒ Ramachandran plot: 96.9% favored    3.1% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A137RM18_outward.pdb    Alignment file: A0A137RM18_out.pir

Procheck score ⇒ Ramachandran plot: 97.7% favored    2.3% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A137RM18_occluded.pdb    Alignment file: A0A137RM18_occ.pir

Procheck score ⇒ Ramachandran plot: 97.7% favored    2.3% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur