| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A137PMG1
dbSWEET id: dbswt_1553
Accession: A0A137PMG1
Uniprot status: Unreviewed
Organism: Lactobacillus johnsonii
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 89
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A137PMG1|A0A137PMG1_LACJH|Unreviewed|Lactobacillus johnsonii|89
MRSFDNKTVLTIGRIGSVLSVLMYVSYIPQIMNNLQENYGNPIQPLVAAINCFIWVLYAL
LREKKDWPLFVANFPGILFGLATFITSLH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 13 Model end: 89 Inward Open: Template: 4X5M.pdb Model structure: A0A137PMG1_inward.pdb Alignment file: A0A137PMG1_inw.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 7.7% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A137PMG1_outward.pdb Alignment file: A0A137PMG1_out.pir Procheck score ⇒ Ramachandran plot: 86.9% favored 12.3% allowed .8% week .0% disallowed Occluded: Model structure: A0A137PMG1_occluded.pdb Alignment file: A0A137PMG1_occ.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 5.4% allowed 1.5% week 2.3% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA