Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A137PMG1

dbSWEET id: dbswt_1553

Accession:   A0A137PMG1

Uniprot status:   Unreviewed

Organism:   Lactobacillus johnsonii

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   89

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A137PMG1|A0A137PMG1_LACJH|Unreviewed|Lactobacillus johnsonii|89
MRSFDNKTVLTIGRIGSVLSVLMYVSYIPQIMNNLQENYGNPIQPLVAAINCFIWVLYAL
LREKKDWPLFVANFPGILFGLATFITSLH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   13     Model end:   89

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A137PMG1_inward.pdb    Alignment file: A0A137PMG1_inw.pir

Procheck score ⇒ Ramachandran plot: 90.8% favored    7.7% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A137PMG1_outward.pdb    Alignment file: A0A137PMG1_out.pir

Procheck score ⇒ Ramachandran plot: 86.9% favored    12.3% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A137PMG1_occluded.pdb    Alignment file: A0A137PMG1_occ.pir

Procheck score ⇒ Ramachandran plot: 90.8% favored    5.4% allowed    1.5% week    2.3% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur