Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A135IB28

dbSWEET id: dbswt_1551

Accession:   A0A135IB28

Uniprot status:   Unreviewed

Organism:   Enterovibrio coralii

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Vibrionales ⇒ Vibrionaceae ⇒ Enterovibrio.

Sequence Information back to top


Sequence length:   97

Substrate Binding Site:   ANAN           CVV:   326       CHI:   -3.4

Selectivity Filter:   AIAI           CVV:   382       CHI:   12.6

Fasta sequence:

>tr|A0A135IB28|A0A135IB28_9GAMM|Unreviewed|Enterovibrio coralii|97
MSVIERIGKALEPLMLVMGLVSPIATLPQIYKLYFSHTEHAAGLSLTTWVLYSFIAMLWT
IYGLYHKNPTIWVGNGLGFLMYLAMVAGIIVRVGMTF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   12     Model end:   91

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A135IB28_inward.pdb    Alignment file: A0A135IB28_inw.pir

Procheck score ⇒ Ramachandran plot: 90.9% favored    6.8% allowed    1.5% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A135IB28_outward.pdb    Alignment file: A0A135IB28_out.pir

Procheck score ⇒ Ramachandran plot: 91.7% favored    6.1% allowed    2.3% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A135IB28_occluded.pdb    Alignment file: A0A135IB28_occ.pir

Procheck score ⇒ Ramachandran plot: 92.4% favored    6.1% allowed    .8% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur