Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A134A9G9
dbSWEET id: dbswt_1548
Accession: A0A134A9G9
Uniprot status: Unreviewed
Organism: Gemella haemolysans
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Bacillales ⇒ Bacillales Family XI. Incertae Sedis ⇒ Gemella.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CPCP CVV: 352 CHI: 1.8
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|A0A134A9G9|A0A134A9G9_9BACL|Unreviewed|Gemella haemolysans|87
MSKQKINRFVGSIGAFIGILVFIAYIPQIIANLQGEKAQPFQPLFAAVSCLIWVIYGWTK
EPKKDWILIIPNAAGVILGGITFITSL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: A0A134A9G9_inward.pdb Alignment file: A0A134A9G9_inw.pir Procheck score ⇒ Ramachandran plot: 86.3% favored 10.5% allowed 2.4% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A134A9G9_outward.pdb Alignment file: A0A134A9G9_out.pir Procheck score ⇒ Ramachandran plot: 84.7% favored 13.7% allowed .0% week 1.6% disallowed Occluded: Model structure: A0A134A9G9_occluded.pdb Alignment file: A0A134A9G9_occ.pir Procheck score ⇒ Ramachandran plot: 89.5% favored 8.1% allowed 1.6% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA