Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A133ZVH7
dbSWEET id: dbswt_1547
Accession: A0A133ZVH7
Uniprot status: Unreviewed
Organism: Gemella haemolysans
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Bacillales ⇒ Bacillales Family XI. Incertae Sedis ⇒ Gemella.
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A133ZVH7|A0A133ZVH7_9BACL|Unreviewed|Gemella haemolysans|85
MNTKFFKILSWVATFTAMLMYISYIPQISGNIHGHKGDFIQPFVAGINCTLWVLYGLLGE
KRDWPIVIANSPGIIFGFTAAFTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: A0A133ZVH7_inward.pdb Alignment file: A0A133ZVH7_inw.pir Procheck score ⇒ Ramachandran plot: 92.7% favored 7.3% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A133ZVH7_outward.pdb Alignment file: A0A133ZVH7_out.pir Procheck score ⇒ Ramachandran plot: 93.5% favored 4.8% allowed .8% week .8% disallowed Occluded: Model structure: A0A133ZVH7_occluded.pdb Alignment file: A0A133ZVH7_occ.pir Procheck score ⇒ Ramachandran plot: 91.9% favored 7.3% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA