Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A133ZF15

dbSWEET id: dbswt_1546

Accession:   A0A133ZF15

Uniprot status:   Unreviewed

Organism:   Lachnoanaerobaculum saburreum

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Clostridia ⇒ Clostridiales ⇒ Lachnospiraceae ⇒ Lachnoanaerobaculum.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CPCP           CVV:   352       CHI:   1.8

Selectivity Filter:   SSSS           CVV:   292       CHI:   -3.2

Fasta sequence:

>tr|A0A133ZF15|A0A133ZF15_9FIRM|Unreviewed|Lachnoanaerobaculum saburreum|87
MSKKKINTFIGSIGAFIGVLVFLSYIPQIIANIGGAKSQPLQPLVAAVSCLLWVIYGLTN
EHKIDYILIIPNAAGVIFGFLTFITAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A133ZF15_inward.pdb    Alignment file: A0A133ZF15_inw.pir

Procheck score ⇒ Ramachandran plot: 88.9% favored    6.3% allowed    .0% week    4.8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A133ZF15_outward.pdb    Alignment file: A0A133ZF15_out.pir

Procheck score ⇒ Ramachandran plot: 88.1% favored    10.3% allowed    1.6% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A133ZF15_occluded.pdb    Alignment file: A0A133ZF15_occ.pir

Procheck score ⇒ Ramachandran plot: 90.5% favored    8.7% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur