Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A131YPE8

dbSWEET id: dbswt_1096

Accession:   A0A131YPE8

Uniprot status:   Unreviewed

Organism:   Rhipicephalus appendiculatus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Chelicerata ⇒ Arachnida ⇒ Acari ⇒ Parasitiformes ⇒ Ixodida ⇒ Ixodoidea ⇒ Ixodidae ⇒ Rhipicephalinae ⇒ Rhipicephalus ⇒ Rhipicephalus.

Sequence Information back to top


Sequence length:   214

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   NAFV           CVV:   403       CHI:   5.3

Fasta sequence:

>tr|A0A131YPE8|A0A131YPE8_RHIAP|Unreviewed|Rhipicephalus_appendiculatus|214
MYSTETAKTIVGDLALVFTIVNYASGVQICRKVREKGGTHDLSPLPFLAGMLATFLWFEY
GVMKGDNILVWVNSIGFLLQMMFLCYFYSYTKVKGTLNWKILVLLFMLAGVYYEVTYFIT
EKDVALSVLGMMGCIAAFLFFASPLSSLLHVVRTQSVETLPFPLILSAFVVSTLWTLYGF
ICQDAFIYTPNIMGALITACQLALFVIYPSAKQY

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   210

Alignment file: A0A131YPE8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A131YPE8_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.5% favored    7.0% allowed    .5% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A131YPE8_outward.pdb

Procheck score ⇒ Ramachandran plot: 90.9% favored    8.0% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A131YPE8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.0% favored    6.4% allowed    .5% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur