Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A131Y2X9

dbSWEET id: dbswt_1095

Accession:   A0A131Y2X9

Uniprot status:   Unreviewed

Organism:   Ixodes ricinus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Chelicerata ⇒ Arachnida ⇒ Acari ⇒ Parasitiformes ⇒ Ixodida ⇒ Ixodoidea ⇒ Ixodidae ⇒ Ixodinae ⇒ Ixodes.

Sequence Information back to top


Sequence length:   204

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   SCCV           CVV:   350       CHI:   8.4

Fasta sequence:

>tr|A0A131Y2X9|A0A131Y2X9_IXORI|Unreviewed|Ixodes_ricinus|204
METTWCVGQVATAVTFVSFFSGLPLVWRMHRQRSSRGVPFLPLVFGCLCTFVWLLYGYAT
NNGTVVFVNKVGTALQLVNVAVHRAYGEVGQDSLVFLAALVFVVAAGAGWKHVSAAHLGM
LGSVVTVCCHLSPLPAIPRVLRDRDASSLPFSIIVSSFVVSLLWGVFGLLLRDVNLYAAN
LFGVVVTAFELFLCVLFPGHAKRT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   199

Alignment file: A0A131Y2X9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A131Y2X9_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.6% favored    9.2% allowed    1.2% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A131Y2X9_outward.pdb

Procheck score ⇒ Ramachandran plot: 90.8% favored    5.8% allowed    3.5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A131Y2X9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    4.0% allowed    1.7% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur