Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A126NE69
dbSWEET id: dbswt_1543
Accession: A0A126NE69
Uniprot status: Unreviewed
Organism: Stenotrophomonas
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Xanthomonadales ⇒ Xanthomonadaceae ⇒ Stenotrophomonas.
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: SNSN CVV: 338 CHI: -8.6
Selectivity Filter: TATA CVV: 320 CHI: 2.2
Fasta sequence:
>tr|A0A126NE69|A0A126NE69_9GAMM|Unreviewed|Stenotrophomonas|85
MDKQLLTEGIGWAASAILLATLIRQIVKQAKTEHPEAISTWLFIGQAAASTLFVIYSILV
GNTVFIVTNSCLLLTALVGQWLSRR
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 8 Model end: 85 Inward Open: Template: 4X5M.pdb Model structure: A0A126NE69_inward.pdb Alignment file: A0A126NE69_inw.pir Procheck score ⇒ Ramachandran plot: 94.2% favored 5.1% allowed .0% week .7% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A126NE69_outward.pdb Alignment file: A0A126NE69_out.pir Procheck score ⇒ Ramachandran plot: 94.9% favored 4.3% allowed .0% week .7% disallowed Occluded: Model structure: A0A126NE69_occluded.pdb Alignment file: A0A126NE69_occ.pir Procheck score ⇒ Ramachandran plot: 96.4% favored 2.9% allowed .7% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA