| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A124SE28
dbSWEET id: dbswt_747
Accession: A0A124SE28
Uniprot status: Unreviewed
Organism: Cynara cardunculus
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ campanulids ⇒ Asterales ⇒ Asteraceae ⇒ Carduoideae ⇒ Cardueae ⇒ Carduinae ⇒ Cynara.
Sequence Information back to top
Sequence length: 256
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMC CVV: 430 CHI: 4.7
Fasta sequence:
>tr|A0A124SE28|A0A124SE28_CYNCS|Unreviewed|Cynara_cardunculus|256
MGAVSILHTVFGIFGDATGLFLFLAPTITFKRILTNKSTEQFSGIPYPMTLLNCLLSAWY
GLPFVSKNNTLVTVINGTGAGIEAIYVLIFIIYAPKKEKAKVLGLVTFVLAAFSTVALVS
VFALHGKSRRYFCGFAAAIFSVIMYGSPLSIMRTVIKTKSVEFMPFFLSLFVFLCGTSWF
IFGLLGNDPFVYVCNGFGSVLGALQLILYAIYRKNKGQKDEKAAAKDGGSTMEMGLVKRP
DKATVTAIQPPENTRV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 214
Alignment file: A0A124SE28.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A124SE28_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.0% favored 3.3% allowed 2.2% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A124SE28_outward.pdb
Procheck score ⇒ Ramachandran plot: 96.2% favored 2.7% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A124SE28_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.0% favored 5.4% allowed .5% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA