| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A121J951
dbSWEET id: dbswt_1540
Accession: A0A121J951
Uniprot status: Unreviewed
Organism: Streptococcus pneumoniae
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 90
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A121J951|A0A121J951_STREE|Unreviewed|Streptococcus pneumoniae|90
MKKNKKVLHAIAVIASVMSVLMYVSYIPQIYGNLHGEKGNPTQPLVAMINCIFWTIHGLY
GDDGETRDKSIIFANVPGIIFGFFAFITAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 12 Model end: 91 Inward Open: Template: 4X5M.pdb Model structure: A0A121J951_inward.pdb Alignment file: A0A121J951_inw.pir Procheck score ⇒ Ramachandran plot: 88.5% favored 6.2% allowed 2.3% week 3.1% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A121J951_outward.pdb Alignment file: A0A121J951_out.pir Procheck score ⇒ Ramachandran plot: 83.8% favored 10.8% allowed 3.1% week 2.3% disallowed Occluded: Model structure: A0A121J951_occluded.pdb Alignment file: A0A121J951_occ.pir Procheck score ⇒ Ramachandran plot: 92.3% favored 6.9% allowed .0% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA