Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A118K3M8

dbSWEET id: dbswt_215

Accession:   A0A118K3M8

Uniprot status:   Unreviewed

Organism:   Cynara cardunculus

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ campanulids ⇒ Asterales ⇒ Asteraceae ⇒ Carduoideae ⇒ Cardueae ⇒ Carduinae ⇒ Cynara.

Sequence Information back to top


Sequence length:   328

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|A0A118K3M8|A0A118K3M8_CYNCS|Unreviewed|Cynara_cardunculus|328
MVGNLAHLTLAFGLLGNIVSFMVFLAPMYASYICFFSFYLFSKPTFYRVYKKKSTEGFQS
EPYVVGLFSAMLWIYYALLKSNVLLLITINSVGCFIETLYICFFLVYAPKKARKVGLTKR
NLVMQMESLKLIVLLIVVGFGLIVVLTQFFASGVTRGVIVGWICLVFSLCVFVAPLGVLR
QVIKTKSVEYMPILLSVALTLSAVMWFFYGLLLGDFNIAIPNVLGFTFGIIQMILYFVYK
NKKPIINEKMSEKGEQKYTIGKMEEQKMVEVKDHKTIDVVKLSANLLSPDVLPVVAKLKE
NEHDAVPVAVHEPEARPTVPNHIIEVAV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   241

Alignment file: A0A118K3M8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A118K3M8_inward.pdb

Procheck score ⇒ Ramachandran plot: 85.9% favored    5.2% allowed    3.8% week    5.2% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A118K3M8_outward.pdb

Procheck score ⇒ Ramachandran plot: 87.8% favored    8.5% allowed    2.3% week    1.4% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A118K3M8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.5% favored    6.1% allowed    1.4% week    .9% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur