Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A118K3M8
dbSWEET id: dbswt_215
Accession: A0A118K3M8
Uniprot status: Unreviewed
Organism: Cynara cardunculus
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ campanulids ⇒ Asterales ⇒ Asteraceae ⇒ Carduoideae ⇒ Cardueae ⇒ Carduinae ⇒ Cynara.
Sequence Information back to top
Sequence length: 328
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A118K3M8|A0A118K3M8_CYNCS|Unreviewed|Cynara_cardunculus|328
MVGNLAHLTLAFGLLGNIVSFMVFLAPMYASYICFFSFYLFSKPTFYRVYKKKSTEGFQS
EPYVVGLFSAMLWIYYALLKSNVLLLITINSVGCFIETLYICFFLVYAPKKARKVGLTKR
NLVMQMESLKLIVLLIVVGFGLIVVLTQFFASGVTRGVIVGWICLVFSLCVFVAPLGVLR
QVIKTKSVEYMPILLSVALTLSAVMWFFYGLLLGDFNIAIPNVLGFTFGIIQMILYFVYK
NKKPIINEKMSEKGEQKYTIGKMEEQKMVEVKDHKTIDVVKLSANLLSPDVLPVVAKLKE
NEHDAVPVAVHEPEARPTVPNHIIEVAV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 241
Alignment file: A0A118K3M8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A118K3M8_inward.pdb
Procheck score ⇒ Ramachandran plot: 85.9% favored 5.2% allowed 3.8% week 5.2% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A118K3M8_outward.pdb
Procheck score ⇒ Ramachandran plot: 87.8% favored 8.5% allowed 2.3% week 1.4% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A118K3M8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.5% favored 6.1% allowed 1.4% week .9% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22